PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv4_097640_szor.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family NF-YA
Protein Properties Length: 310aa    MW: 34774.6 Da    PI: 8.5685
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv4_097640_szor.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA84.22e-26144199158
           CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         d p+YVN+KQy++Il+RR++Rak   +++   ++ kpy+heSRh+hA+rR+Rg gGrF
  Bv4_097640_szor.t1 144 DGPIYVNPKQYHGILRRRKMRAKEGMKSRS--AKDKPYIHESRHRHACRRARGAGGRF 199
                         57**********************997766..899**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.3E-25142202IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115228.854143202IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.6E-23146199IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.8E-19146168IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.8E-19176199IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MQKSATNRQV SSIGSMPWWV SAGSQEEHID STNLNQFDWV GEHQKSQHIM SGIPEKEKEA  60
AFHLAFCAGD NKNSSKENNV RDNQTNSFQQ SSLPQEKSYF ELGLGQPMVY GNYPLADQCH  120
GLFAVYGTQP TGRVMLPFSV TTEDGPIYVN PKQYHGILRR RKMRAKEGMK SRSAKDKPYI  180
HESRHRHACR RARGAGGRFL NIKNLENEKN KQETERTSDQ LTFPSSQSSS SEVVQSEGGH  240
MNSSKEVSDS KSSILSGSEV TSMYYSKEFD CFGLNPSRPF AFHPLPSMEG NRQGGNWVTT  300
PDGCCNLFKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A6e-14144201261HAPB protein
4g91_A6e-14144201261HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183192RHRHACRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010695104.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLA0A0J8BCW40.0A0A0J8BCW4_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-23nuclear factor Y, subunit A10